PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OPUNC04G18620.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family SBP
Protein Properties Length: 361aa    MW: 37474.1 Da    PI: 9.3484
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OPUNC04G18620.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP129.21.5e-40110186177
                      --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S-- CS
              SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkq 77 
                      +CqvegC+  l+ +keyhrrhkvCevh+kap v+v+g+eqrfCqqCsrfh l efD++k+sCrrrLa+hnerrr+++
  OPUNC04G18620.1 110 RCQVEGCDITLQGVKEYHRRHKVCEVHAKAPRVVVHGTEQRFCQQCSRFHVLAEFDDAKKSCRRRLAGHNERRRRSN 186
                      6*************************************************************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.106.9E-34107172IPR004333Transcription factor, SBP-box
PROSITE profilePS5114132.693108185IPR004333Transcription factor, SBP-box
SuperFamilySSF1036124.12E-39109189IPR004333Transcription factor, SBP-box
PfamPF031103.3E-32111184IPR004333Transcription factor, SBP-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 361 aa     Download sequence    Send to blast
MEGNGCSGGG GSGETPRGVV GMHWAPVVTS APCPQPPFLP PAPCRPDVQM QQQGLTCLKL  60
GKRPCFWGGG NGAGQVAQGS AGAGGGGGGG SADQGRRKEK AATAAPVVPR CQVEGCDITL  120
QGVKEYHRRH KVCEVHAKAP RVVVHGTEQR FCQQCSRFHV LAEFDDAKKS CRRRLAGHNE  180
RRRRSNASEA MTRGSAHPHG MTVLGHGFPP YGLPTSSAGA LSLLSSARAT GPWLIPTPDI  240
SARSSAALDE LIAENRAALL SWQFFSDRQP AAGRPMGRAP AETAGGSWHA HLQARPPPSG  300
AGGQHEHQSG HVTLDLMQAT TAAGGGAPFR PVPARPAKEG GDAGCTSDAW TSSPMEGARV  360
V
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ul4_A5e-311111841184squamosa promoter binding protein-like 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0687490.0AK068749.1 Oryza sativa Japonica Group cDNA clone:J013158C23, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015635344.10.0PREDICTED: squamosa promoter-binding-like protein 7
SwissprotQ01JD10.0SPL7_ORYSI; Squamosa promoter-binding-like protein 7
TrEMBLA0A0E0KTM00.0A0A0E0KTM0_ORYPU; Uncharacterized protein
STRINGORGLA04G0180000.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP103033439
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G33810.11e-34squamosa promoter binding protein-like 3